"context" : "", { { setWarning(pagerId); "eventActions" : [ "actions" : [ "action" : "rerender" { "event" : "editProductMessage", "initiatorBinding" : true, ] } "selector" : "#kudosButtonV2_7", "showCountOnly" : "false", { "event" : "expandMessage", ] "action" : "rerender" "context" : "", "messageViewOptions" : "1111110111111111111110111110100101001101" ] LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); { "context" : "envParam:quiltName", { { "initiatorBinding" : true, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); { LITHIUM.Dialog.options['-2019888074'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "context" : "", "context" : "", ] "context" : "", { "context" : "", } ] "context" : "envParam:feedbackData", { { "kudosable" : "true", }); ] ] } "event" : "addThreadUserEmailSubscription", "action" : "pulsate" ] { { $(document).ready(function(){ "context" : "", "useCountToKudo" : "false", "event" : "RevokeSolutionAction", { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); "event" : "removeThreadUserEmailSubscription", { "context" : "", { "context" : "", "actions" : [ { "action" : "rerender" "actions" : [ "actions" : [ { ', 'ajax'); } "event" : "removeMessageUserEmailSubscription", } "event" : "addMessageUserEmailSubscription", ', 'ajax'); "useTruncatedSubject" : "true", "actions" : [ ] "componentId" : "kudos.widget.button", "initiatorDataMatcher" : "data-lia-kudos-id" { var count = 0; "actions" : [ "componentId" : "forums.widget.message-view", LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "eventActions" : [ }, LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, "event" : "addMessageUserEmailSubscription", }, { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "useSimpleView" : "false", "quiltName" : "ForumMessage", } }); ], { { "; "actions" : [ { "action" : "rerender" }, "action" : "rerender" { "event" : "MessagesWidgetCommentForm", } } "context" : "envParam:quiltName", } } } ] "actions" : [ "disallowZeroCount" : "false", }, }); ] LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] "selector" : "#kudosButtonV2_7", "context" : "envParam:quiltName,message", }, if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") } "action" : "rerender" "kudosLinksDisabled" : "false", "event" : "RevokeSolutionAction", "event" : "markAsSpamWithoutRedirect", } }, } { }, } { { }); ] "action" : "rerender" //$('#community-menu-toggle').removeClass('active') "actions" : [ "event" : "approveMessage", "quiltName" : "ForumMessage", ] { "showCountOnly" : "false", } }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); })(LITHIUM.jQuery); { { { } "action" : "rerender" "action" : "rerender" "actions" : [ "context" : "", "context" : "envParam:quiltName,message", LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "action" : "rerender" "context" : "", { { "linkDisabled" : "false" CookieManager = { ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ], "actions" : [ "action" : "pulsate" "action" : "rerender" "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); ] { { "actions" : [ { "useSimpleView" : "false", }, "action" : "rerender" ], ] "useSimpleView" : "false", "action" : "pulsate" "action" : "rerender" "action" : "pulsate" "action" : "rerender" } "action" : "rerender" } "action" : "rerender" "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2425286 .lia-rating-control-passive', '#form_5'); "truncateBody" : "true", { "actions" : [ } { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.AjaxSupport.useTickets = false; ] "buttonDialogCloseAlt" : "Schließen", "actions" : [ } } "context" : "lia-deleted-state", ], $(document).ready(function(){ "context" : "", } { "context" : "envParam:selectedMessage", count = 0; } } CookieManager = { "action" : "rerender" "dialogKey" : "dialogKey" }); if (1 != val) "action" : "rerender" "actions" : [ { "}); { "actions" : [ } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2425339,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, { "action" : "rerender" "actions" : [ } "actions" : [ ] }, { LITHIUM.AjaxSupport.useTickets = false; "event" : "MessagesWidgetMessageEdit", "event" : "MessagesWidgetAnswerForm", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "actions" : [ o.innerHTML = "Page number can\'t exceed 2. } "context" : "", "actions" : [ } { { { }, })(LITHIUM.jQuery); "actions" : [ "action" : "pulsate" M-net , a regional carrier and ISP, offers native IPv6 for their customers. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { clearWarning(pagerId); } } { clearWarning(pagerId); "actions" : [ "event" : "kudoEntity", "initiatorDataMatcher" : "data-lia-kudos-id" "showCountOnly" : "false", "context" : "envParam:quiltName", { { }, "quiltName" : "ForumMessage", }, "actions" : [ "parameters" : { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } { }, { { "context" : "", "kudosable" : "true", }, { "event" : "addThreadUserEmailSubscription", "action" : "rerender" { } }, $(document).ready(function(){ { return; ', 'ajax'); ] ] "selector" : "#kudosButtonV2_5", .attr('aria-hidden','false') "context" : "envParam:quiltName", }, } "actions" : [ { "event" : "ProductAnswerComment", "context" : "", "context" : "envParam:selectedMessage", "action" : "rerender" }, "context" : "", // Set start to true only if the first key in the sequence is pressed "context" : "lia-deleted-state", LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'BJy5FsGprmieAhQsKF1zGQyjvncZ7FWTAkuov1elgU4. "disallowZeroCount" : "false", "initiatorBinding" : true, "context" : "", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { ] "kudosable" : "true", { }, "kudosable" : "true", "actions" : [ { o.innerHTML = "Page must be in a numeric format. })(LITHIUM.jQuery); })(LITHIUM.jQuery); }, }, }, ], { } "event" : "ProductMessageEdit", "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "deleteMessage", "actions" : [ "actions" : [ LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); // enable redirect to login page when "logmein" is typed into the void =) }, $(document).ready(function(){ element.find('li').removeClass('active'); "revokeMode" : "true", "context" : "", { LITHIUM.Dialog.options['1454526902'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "", "action" : "rerender" function clearWarning(pagerId) { }, count++; "context" : "", }, { { "event" : "kudoEntity", "actions" : [ "useSimpleView" : "false", "context" : "", "message" : "2425339", "action" : "rerender" { "action" : "pulsate" "action" : "rerender" "event" : "kudoEntity", ] ] { } "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); { ] "actions" : [ "}); $(this).toggleClass("view-btn-open view-btn-close"); "closeEvent" : "LITHIUM:lightboxCloseEvent", LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); ] "context" : "envParam:quiltName,message", "actions" : [ "action" : "rerender" } ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ }, "event" : "removeThreadUserEmailSubscription", ] "event" : "MessagesWidgetAnswerForm", watching = false; "; "}); "action" : "pulsate" ] } "revokeMode" : "true", "actions" : [ "eventActions" : [ "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/158050","ajaxErrorEventName":"LITHIUM:ajaxError","token":"B5RKray7V-_HqkhqB5rT2LnMYuWmT_5_svqkldjlB2g. "componentId" : "kudos.widget.button", }, "actions" : [ "useSubjectIcons" : "true", } var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "action" : "rerender" "action" : "rerender" "useSimpleView" : "false", "context" : "lia-deleted-state", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Internet-Endgeraete/thread-id/158050","ajaxErrorEventName":"LITHIUM:ajaxError","token":"sFHqTmRmp4fxDFldh6qTD0EopiR1Ks0e5ZwB-2YI1Q8. ] { ] "event" : "kudoEntity", "quiltName" : "ForumMessage", } "context" : "", } var count = 0; { } { ] "kudosable" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); } "context" : "envParam:entity", "action" : "rerender" { "context" : "", "action" : "rerender" "actions" : [ "context" : "", "displaySubject" : "true", "event" : "markAsSpamWithoutRedirect", "action" : "rerender" } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, { "event" : "approveMessage", } ] { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1126,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXAlAAA1BTDlcGARgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBUFDAcAVAYPVhQHBgFVSQEKVgBIDgRbCk9QBVxUUQFTVlcEWApAThUPVn1bVgB\/AhsIQCtZEFBBWlcRGyNXVgUHRQVQR1EQSRQNWmAHEUMyB2JBVxdPRAMQMSd7IXZnFFsBFiBrfS9CWgFGQFVVAEVGbnonMHJEQVxEWwYYD10PXUJ7LXh6YBJaFBtE"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { { { { "actions" : [ ] LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "actions" : [ watching = false; "actions" : [ }); ;(function($) { }, "actions" : [ "componentId" : "kudos.widget.button", }, "context" : "envParam:entity", LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); count = 0; "action" : "rerender" }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); } } "event" : "kudoEntity", "action" : "rerender" { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#pageInformation","feedbackSelector":".InfoMessage"}); "includeRepliesModerationState" : "false", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); $(document).ready(function() { "revokeMode" : "true", "context" : "", } "action" : "rerender" { } { if ( neededkeys[count] == key ) { } { { "quiltName" : "ForumMessage", { }, "actions" : [ { LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "addClassName" }, }); "action" : "pulsate" "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ { { "event" : "MessagesWidgetCommentForm", ] "action" : "rerender" "disallowZeroCount" : "false", } document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); "context" : "", { { "selector" : "#kudosButtonV2_4", }); } else { o.innerHTML = "Page must be an integer number. "context" : "", } "}); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2425339 .lia-rating-control-passive', '#form_7'); LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; }, ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, '8ojJ3lra2phZHTvyFC5wtAV7gnUqyk84ninxKsYHPa4. }, "actions" : [ "actions" : [ { } "entity" : "2425207", "quiltName" : "ForumMessage", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2425389 .lia-rating-control-passive', '#form_8'); { "context" : "envParam:selectedMessage", { "event" : "ProductMessageEdit", } } LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233894}); LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); Bist du sicher, dass du fortfahren möchtest? ] }, }, "kudosable" : "true", } "event" : "ProductAnswerComment", "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "", ] "action" : "rerender" } "actions" : [ ] "disableLabelLinks" : "false", { "actions" : [ } } ] "kudosLinksDisabled" : "false", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2423352}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2423365}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2424121}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2425091}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2425140}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2425207}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2425286}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2425319}},{"elementId":"link_46","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2425339}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2425389}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2459463}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2513747}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2525974}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2540369}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519324}},{"elementId":"link_60","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543611}},{"elementId":"link_61","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543588}},{"elementId":"link_62","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543515}},{"elementId":"link_63","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543376}},{"elementId":"link_64","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543372}},{"elementId":"link_65","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543343}},{"elementId":"link_66","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543287}},{"elementId":"link_67","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543269}},{"elementId":"link_68","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543219}},{"elementId":"link_69","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543190}}]); { }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); "parameters" : { } ] "initiatorBinding" : true, "actions" : [ } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "useSubjectIcons" : "true", "action" : "rerender" "}); { "actions" : [ } } } "event" : "unapproveMessage", { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2423352,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "pulsate" "event" : "MessagesWidgetEditCommentForm", "context" : "", "context" : "envParam:quiltName,message", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2425389 .lia-rating-control-passive', '#form_8'); }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); { "action" : "rerender" { "event" : "MessagesWidgetMessageEdit", "event" : "removeMessageUserEmailSubscription", } ] "disableLabelLinks" : "false", { // --> LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); } } var key = e.keyCode; logmein: [76, 79, 71, 77, 69, 73, 78], "context" : "", "event" : "QuickReply", } "actions" : [ return; }, "action" : "rerender" "actions" : [ { "event" : "unapproveMessage", ] "context" : "envParam:selectedMessage", { ] "parameters" : { ] "context" : "", o.innerHTML = "Page must be an integer number. "event" : "ProductAnswer", "}); "actions" : [ "actions" : [ LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "lia-deleted-state", { { "event" : "ProductAnswerComment", // We're good so far. element.children('ul').slideDown(); ] ] ], "selector" : "#kudosButtonV2_3", "action" : "rerender" "eventActions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", "selector" : "#messageview_2", "actions" : [ o.innerHTML = "Page must be an integer number. }, }, { "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "envParam:entity", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2425339,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } } ] if ( Number(val) > 2 ) ;(function($) { } "truncateBody" : "true", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2425140,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ "action" : "rerender" }, // If watching, pay attention to key presses, looking for right sequence. ] { "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] "action" : "rerender" } { "event" : "ProductAnswer", "useSubjectIcons" : "true", }, "actions" : [ { { } { "actions" : [ "selector" : "#messageview_8", { } setWarning(pagerId); { { } "context" : "", "event" : "removeThreadUserEmailSubscription", ] "message" : "2425207", } }, "context" : "", "action" : "rerender" "context" : "envParam:quiltName,message", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); "componentId" : "forums.widget.message-view", { "disableLinks" : "false", })(LITHIUM.jQuery); ], { ] "showCountOnly" : "false", "kudosable" : "true", ] } } "context" : "", "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); { } "context" : "envParam:quiltName,product,contextId,contextUrl", { "event" : "MessagesWidgetMessageEdit", }, ] } "context" : "envParam:quiltName", }, "actions" : [