}, $(document).ready(function(){ "context" : "", "actions" : [ { ] { { { } { ', 'ajax'); "context" : "lia-deleted-state", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", } "context" : "lia-deleted-state", "useSubjectIcons" : "true", "actions" : [ LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "action" : "rerender" { "; } "context" : "", "action" : "rerender" { { "linkDisabled" : "false" LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); "accessibility" : false, var msg = $(".message-uid-1693906"); { count++; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); ] $(this).removeAttr('href'); window.location.replace('/t5/user/userloginpage'); $('#vodafone-community-header .lia-search-toggle').click(function() { }, }, }, "context" : "envParam:feedbackData", ] "action" : "rerender" } ] LITHIUM.Dialog.options['-167886007'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "useTruncatedSubject" : "true", "actions" : [ }, // enable redirect to login page when "logmein" is typed into the void =) // Oops. "activecastFullscreen" : false, "disallowZeroCount" : "false", "actions" : [ Ich beziehe Telefon und Internet über einen CBN-Kabelrouter von Vodafone. ] { "context" : "envParam:quiltName", "event" : "markAsSpamWithoutRedirect", LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); }, Auf der Benutzeroberfläche der EasyBox … } "action" : "rerender" "disableKudosForAnonUser" : "false", "event" : "MessagesWidgetAnswerForm", "event" : "deleteMessage", } } "actions" : [ }, "accessibility" : false, } welche IP-Adresse wird eigentlich geändert, wenn ich meinen Router neustarte? resetMenu(); { } window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":479,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk12FlZbXURIfwhNVxAMUhAYdFFAQHVVHHNWFlI4GnpkRFEbB1JGCxReAUdWWm5KQgIUQj5NBlIMAgMAUBRKG1QQA1oBfFcWCFQEUg8LUlcBVQUGDR5HXQVsQQcQfgAXCRkDSRQNWmIDBVIqVF5REF8UIFZAFw9jC0VaV2IEUQMbHkAJVClaUV1eABRcG1QDDkQBFx8WWQZ0CU0QWEBRBVlAURBJFA1aZhpADUZTCwECBw8AAR8AUFZSGAcCC1cbBFsBVU9SVAYFAVMABlYJBFtAG0ZeUHpdAVMvXRBYQHYWVltdRC5\/NhseQAlUNlBAQGRXZxNcQBtADUZmdnh3JmJGUFZCJGUreBNZVxZFB15XEUJgLHBhcRIRWRZQUUwLU1kKE3h7KH8yGQ1AH0o="}. "context" : "", "context" : "", "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } } } } "messageViewOptions" : "1111110111111111111110111110100101001101" element.children('ul').slideDown(); { Was ist, wenn die des Routers geändert wird, und jemand meine IPv4 oder IPv6 hat, kann er meinen Router durch diese nicht dann auch überlasten? 2 Klicken Sie auf Login zu Mein Kabel und dann auf Jetzt registrieren. { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/75143","ajaxErrorEventName":"LITHIUM:ajaxError","token":"UM4M2lbE3HbY6njnrAGB32jBpL-6AUMrFT-edHeE4YU. Ansonsten gibt es auf der Admin-Oberfläche des Routers bestimmt auch eine Möglichkeit, die IP zu erneuern. ] Ist es irgendwie schädlich für mein Internet?´Hoffe das mich jemand aufklären kann. "actions" : [ LITHIUM.Dialog({ "action" : "rerender" "action" : "rerender" }); ] Wie es bei CBN ist, weiß ich leider nicht, aber in der FritzBox geht's recht einfach. } ] ] window.location.replace('/t5/user/userloginpage'); ], "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "parameters" : { Behoben Eisleben: Einschränkung der Festnetz-Telefonie, Behoben Oscherlseben: Einschränkung der Mobilen Telefonie und Daten, MeinVodafone-App/-Web:  Automatisches Logout beim Aufrufen von "Mein Tarif", Selfservice-MeinVodafone-App-Quick-Check-Verbrauchsabfrage der automatische Login über W-Lan funktioniert nicht, Nähere Informationen dazu findet Ihr im Eilmeldungsboard. "actions" : [ "event" : "deleteMessage", "action" : "rerender" } } "actions" : [ "actions" : [ "event" : "kudoEntity", "context" : "", "revokeMode" : "true", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1693906,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. return; "event" : "ProductMessageEdit", }); "disableKudosForAnonUser" : "false", "action" : "rerender" { "includeRepliesModerationState" : "false", ] } "actions" : [ "action" : "rerender" LITHIUM.Dialog.options['-580642605'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "addClassName" }, { "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, { { "event" : "MessagesWidgetAnswerForm", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'u0D0OVNB60x9dTzIyY-BHpAdr93BmL0TxvS7QYWy_Zg. $(document).keydown(function(e) { "componentId" : "forums.widget.message-view", "actions" : [ } LITHIUM.AjaxSupport.ComponentEvents.set({ ] "actions" : [ "actions" : [ }, } }, "event" : "ProductMessageEdit", } else { ] "event" : "addMessageUserEmailSubscription", ] } "action" : "rerender" "action" : "rerender" { { "actions" : [ "dialogKey" : "dialogKey" }, } "event" : "ProductAnswerComment", "parameters" : { "truncateBodyRetainsHtml" : "false", if ( !watching ) { }, { "defaultAriaLabel" : "", "action" : "pulsate" "event" : "MessagesWidgetEditAction", { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1692772 .lia-rating-control-passive', '#form_1'); // console.log(key); var clickedDomElement = $(this); "event" : "expandMessage", logmein: [76, 79, 71, 77, 69, 73, 78], lithstudio: [], "event" : "MessagesWidgetEditAnswerForm", { } { $('.css-menu').removeClass('cssmenu-open') watching = false; }, "context" : "", }, ] }); } "event" : "ProductAnswerComment", $(document).ready(function(){ "event" : "unapproveMessage", } "Ich hab jetzt seine IP-Adresse. Execute whatever should happen when entering the right sequence } "context" : "", "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "event" : "removeThreadUserEmailSubscription", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); Wollen Sie also auf Nummer sicher gehen oder brauchen das Menü gerade, weil das WLAN nicht funktioniert, schließen Sie den Router am besten per LAN-Kabel an den PC an. ], $(this).removeClass('active'); Bist du sicher, dass du fortfahren möchtest? "activecastFullscreen" : false, "linkDisabled" : "false" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivKIP/thread-id/75143","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Wg8wqNSBVBJz2OmDa90iJiTUDuwCNahwbNST7ewxBow. "action" : "rerender" // console.log('watching: ' + key); LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234532}); "useSimpleView" : "false", "actions" : [ LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); "context" : "", } }, "action" : "rerender" "}); { { "action" : "pulsate" { "includeRepliesModerationState" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/75143","ajaxErrorEventName":"LITHIUM:ajaxError","token":"QXW142crSDnQX26LYuDDicubN8B8RtmQGAcMxGHJon4. LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "actions" : [ "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/75143","ajaxErrorEventName":"LITHIUM:ajaxError","token":"jlwlkHuN0J6I2kdZvx05Iw0gGEFdfwbfZiRjfTiFS9Y. "context" : "envParam:selectedMessage", { { "closeEvent" : "LITHIUM:lightboxCloseEvent", ] { }, "context" : "envParam:selectedMessage", "componentId" : "forums.widget.message-view", "action" : "rerender" { "event" : "AcceptSolutionAction", "forceSearchRequestParameterForBlurbBuilder" : "false", } { // If watching, pay attention to key presses, looking for right sequence. logmein: [76, 79, 71, 77, 69, 73, 78], }, }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "actions" : [ // Set start to true only if the first key in the sequence is pressed "context" : "", "event" : "ProductMessageEdit", "event" : "MessagesWidgetMessageEdit", }, ;(function($) { // We're good so far. resetMenu(); "kudosLinksDisabled" : "false", Willkommen im Kundencenter von Vodafone. Willkommen im MeinKabel-Kundenportal - Nutze als Kunde das Online Hilfe- und Service-Angebot von Vodafone Kabel Deutschland. "revokeMode" : "true", { "action" : "pulsate" "useSimpleView" : "false", }, Mit der DynDNS-Adresse bekommen Sie eine feste Subdomain, die automatisch mit der IP-Adresse der HomeBox verbunden wird. { // --> "initiatorBinding" : true, "action" : "rerender" if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { ;(function($) { "truncateBody" : "true", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); { } "action" : "rerender" "selector" : "#kudosButtonV2_1", "event" : "MessagesWidgetCommentForm", ] "action" : "rerender" ], "action" : "rerender" { "context" : "envParam:quiltName,product,contextId,contextUrl", // just for convenience, you need a login anyways... "context" : "envParam:feedbackData", { ] "context" : "", ] { "triggerSelector" : ".lia-panel-dialog-trigger-event-click", LITHIUM.Dialog.options['537737561'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" }); }(LITHIUM.jQuery)); ] "disableKudosForAnonUser" : "false", "event" : "MessagesWidgetMessageEdit", } "event" : "removeMessageUserEmailSubscription", "action" : "rerender" { ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, }, } $(this).next().toggle(); "action" : "addClassName" LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; { }); "action" : "rerender" { "actions" : [ "action" : "rerender" if ( key == neededkeys[0] ) { "context" : "envParam:quiltName,message,product,contextId,contextUrl", watching = false; }, window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":479,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk12FlZbXURIfwhNVxAMUhAYdFFAQHVVHHNWFlI4GnpkRFEbB1JGCxReAUdWWm5KQgIUQj5NBlIMAgMAUBRKG1QQA1oBfFcWCFQEUg8LUlcBVQUGDR5HXQVsQQcQfgAXCRkDSRQNWmIDBVIqVF5REF8UIFZAFw9jC0VaV2IEUQMbHkAJVClaUV1eABRcG1QDDkQBFx8WWQZ0CU0QWEBRBVlAURBJFA1aZhpADUZTCwECBw8AAR8AUFZSGAcCC1cbBFsBVU9SVAYFAVMABlYJBFtAG0ZeUHpdAVMvXRBYQHYWVltdRC5\/NhseQAlUNlBAQGRXZxNcQBtADUZmdnh3JmJGUFZCJGUreBNZVxZFB15XEUJgLHBhcRIRWRZQUUwLU1kKE3h7KH8yGQ1AH0o="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; Vodafone live! "parameters" : { LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" "selector" : "#messageview_0", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/75143","ajaxErrorEventName":"LITHIUM:ajaxError","token":"jlwlkHuN0J6I2kdZvx05Iw0gGEFdfwbfZiRjfTiFS9Y. "event" : "MessagesWidgetMessageEdit", "initiatorBinding" : true, } ] { } "action" : "rerender" var count = 0; $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() { }, "context" : "lia-deleted-state", }, "context" : "", "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_1ed96f8adfce50', 'enableAutoComplete', '#ajaxfeedback_1ed96f8adfce50_0', 'LITHIUM:ajaxError', {}, '1xYbcROzhhXdOPHc5ZUQiFdNq9baYFCP62odOsvvXyA. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_0","feedbackSelector":".InfoMessage"}); { { "eventActions" : [ "}); ] ] "action" : "rerender" "event" : "unapproveMessage", Danke! "quiltName" : "ForumMessage", "componentId" : "forums.widget.message-view", } ] "actions" : [ "context" : "", "disableLinks" : "false", })(LITHIUM.jQuery); // Pull in global jQuery reference "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", } "event" : "editProductMessage", "actions" : [ "activecastFullscreen" : false, "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "actions" : [ ] $('li.close-on-click').on('click',resetMenu); } } LITHIUM.AjaxSupport.useTickets = false; { "action" : "rerender" { "event" : "removeThreadUserEmailSubscription", count = 0; "action" : "rerender" }, "actions" : [ }, { "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "", } else { "buttonDialogCloseAlt" : "Schließen", "actions" : [ "action" : "rerender" '; "action" : "rerender" "event" : "ProductMessageEdit", "event" : "deleteMessage", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); } LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234532}); "actions" : [ ] { var watching = false; ] { } LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_1ed96f8adfce50_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/ArchivKIP/thread-id/75143&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "event" : "ProductAnswerComment", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); { //$('#lia-body').removeClass('lia-window-scroll'); //$('#vodafone-community-header').css('display','block'); ] { $('#node-menu li.has-sub>a').on('click', function(){ Dank der großen Programmvielfalt kannst Du immer genau das schauen, wonach Dir gerade ist. ] "actions" : [ ] "event" : "MessagesWidgetEditAnswerForm", } { "action" : "rerender" { } ] ] }); "context" : "envParam:selectedMessage", "displayStyle" : "horizontal", "displaySubject" : "true", } ] { "action" : "rerender" { "context" : "", { ] "action" : "rerender" } ], ] } "event" : "MessagesWidgetEditCommentForm", "truncateBody" : "true", "actions" : [ } "context" : "", "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "MessagesWidgetAnswerForm", "actions" : [ { ] { })(LITHIUM.jQuery); // Pull in global jQuery reference "action" : "rerender" }, "action" : "rerender" "actions" : [ { ] "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ } "event" : "deleteMessage", { Schließlich hat man ja mehrere IP-Adressen: IPv4, IPv6, die des Routers (Standardgateway) und die des Anbieters. "messageViewOptions" : "1111110111111111111110111110100101001101" https://pbs.twimg.com/media/Cz46sw6WIAAA4ny?format=jpg&name=small. "context" : "", "action" : "rerender" }, "event" : "AcceptSolutionAction", } LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); } { "event" : "addMessageUserEmailSubscription", "context" : "envParam:selectedMessage", "context" : "", "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" "actions" : [ Nun habe ich seit Wochen das Problem das mein WLAN dauernd die Verbindung verliert und sich trennt....ich habe nichts verstellt und sitze genau daneben,über LAN Kabel funktioniert alles wunderbar. { LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, event.preventDefault(); var handleOpen = function(event) { var key = e.keyCode; "disableLinks" : "false", $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); ;(function($) { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] } if (event.target.matches('.redirect')) { } "actions" : [ })(LITHIUM.jQuery); "action" : "rerender"